A15175
EIF4ENIF1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15175
- Additional Names:
- 4E-T|Clast4|EIF4ENIF1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 178kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LGGRRIGSGRIISARTFEKDHRLSDKDLRDLRDRDRERDFKDKRFRREFGDSKRVFGERRRNDSYTEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGR
- Uniprot:
- Q9NRA8
- Synonyms:
- 2610509L04Rik;4E-T;4E-transporter;Clast4;eIF4E transporter;Eukaryotic translation initiation factor 4E nuclear import factor 1;eukaryotic translation initiation factor 4E transporter
- Extra Details:
- The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice