HEY2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15143
Additional Names:: bHLHb32|CHF1|GRIDLOCK|GRL|HERP1|HESR2|HEY2|HRT2
Application:: ELISA, WB
Molecular Weight:: 36kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHL
Uniprot:: Q9UBP5
Synonyms:: bHLHb32;cardiovascular basic helix-loop-helix factor 1;cardiovascular helix-loop-helix factor 1;CHF1;class B basic helix-loop-helix protein 32;GRIDLOCK;GRL;hairy and enhancer of split-related protein 2;hairy-related transcription factor 2;hairy/enhancer-of-split related with YRPW motif 2;hairy/enhancer-of-split related with YRPW motif protein 2;hCHF1;HERP1;HES-related repressor protein 1;HES-related repressor protein 2;HESR-2;HESR2;hHRT2;HRT-2;HRT2;protein gridlock homolog
Extra Details:: This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repress transcription. Expression of this gene is induced by the Notch signal transduction pathway. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternatively spliced transcript variants have been found, but their biological validity has not been determined.

Shipping Conditions:: Blue Ice