A15142
TRAM1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15142
- Additional Names:
- PNAS8|TRAM|TRAM1|TRAMP
- Application:
- ELISA, WB
- Molecular Weight:
- 45kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- CVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS
- Uniprot:
- Q15629
- Synonyms:
- PNAS8;TRAM;TRAMP;translocating chain-associated membrane protein 1;translocating chain-associating membrane protein;translocation-associating membrane protein 1
- Extra Details:
- This gene encodes a multi-pass membrane protein that is part of the mammalian endoplasmic reticulum. The encoded protein influences glycosylation and facilitates the translocation of secretory proteins across the endoplasmic reticulum membrane by regulating which domains of the nascent polypeptide chain are visible to the cytosol during a translocational pause.
- Shipping Conditions:
- Blue Ice