A15137
SLC22A7 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15137
- Additional Names:
- hOAT11|NLT|OAT2|SLC22A7
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQKG
- Uniprot:
- Q9Y694
- Synonyms:
- hOAT11;hOAT2;liver-specific transporter;NLT;novel liver transporter;OAT2;organic anion transporter 11;organic anion transporter 2;solute carrier family 22 (organic anion transporter), member 7;solute carrier family 22 member 7
- Extra Details:
- The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.
- Shipping Conditions:
- Blue Ice