RRAGA Rabbit polyclonal antibody

Size

£152.00

SKU:: A15134
Additional Names:: FIP-1|FIP1|RAGA|RRAGA
Application:: ELISA, WB, IHC-P
Molecular Weight:: 33kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR
Uniprot:: Q7L523
Synonyms:: adenovirus E3 14.7 kDa-interacting protein 1;adenovirus E3-14.7K interacting protein 1;FIP-1;FIP1;rag A;RAGA;ras-related GTP-binding protein A
Extra Details:: Enables several functions, including GTP binding activity; protein dimerization activity; and ubiquitin protein ligase binding activity. Involved in several processes, including cellular response to amino acid starvation; negative regulation of autophagy; and positive regulation of TORC1 signaling. Located in lysosome and nucleus. Colocalizes with GATOR1 complex.