OXSR1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15126
Additional Names:: OSR1|OXSR1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSV
Uniprot:: O95747
Synonyms:: OSR1;oxidative stress responsive 1;oxidative stress-responsive 1 protein;serine/threonine-protein kinase OSR1
Extra Details:: The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton.