A15116
CDC23 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15116
- Additional Names:
- ANAPC8|APC8|CDC23|CUT23
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 69kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA
- Uniprot:
- Q9UJX2
- Synonyms:
- ANAPC8;anaphase-promoting complex subunit 8;APC8;cell division cycle 23 homolog;cell division cycle protein 23 homolog;CUT23;cyclosome subunit 8
- Extra Details:
- The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.
- Shipping Conditions:
- Blue Ice







