A15106
TRAF3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15106
- Additional Names:
- CAP-1|CAP1|CD40bp|CRAF1|IIAE5|LAP1|RNF118|TRAF3
- Application:
- ELISA, WB
- Molecular Weight:
- 64kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKV
- Uniprot:
- Q13114
- Synonyms:
- CAP-1;CAP1;CD40 associated protein 1;CD40 binding protein;CD40 receptor associated factor 1;CD40 receptor-associated factor 1;CD40-binding protein;CD40bp;CRAF1;IIAE5;LAP1;LMP1-associated protein 1;RING-type E3 ubiquitin transferase TRAF3;RNF118;TNF receptor-associated factor 3
- Extra Details:
- The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. The protein also plays a role in the regulation of antiviral response. Mutations in this are associated with Encephalopathy, acute, infection-induced, herpes-specific 5.
- Shipping Conditions:
- Blue Ice



