PDCD7 Rabbit monoclonal antibody

Size

POA

SKU:: A1510
Additional Names:: 59K|ES18|HES18|PDCD7
Application:: ELISA, WB, IHC-P
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRPFPG
Uniprot:: Q8N8D1
Synonyms:: 59K;apoptosis-related protein ES18;ES18;HES18;programmed cell death protein 7;U11/U12 snRNP 59K
Extra Details:: This gene encodes a 59 kDa protein that is associated with the U11 small nuclear ribonucleoprotein (snRNP), which is a component of the minor U12-type spliceosome responsible for catalyzing pre-mRNA splicing of U12-type introns.