RPL6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15094
Additional Names:: eL6|L6|RPL6|SHUJUN-2|TAXREB107|TXREB1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQLQGYLRSVFALTNGIYPHKLVF
Uniprot:: Q02878
Synonyms:: 60S ribosomal protein L6;DNA-binding protein TAXREB107;L6;large ribosomal subunit protein eL6;neoplasm-related protein C140;SHUJUN-2;tax-responsive enhancer element-binding protein 107;TAXREB107;TXREB1
Extra Details:: This gene encodes a protein component of the 60S ribosomal subunit. This protein can bind specifically to domain C of the tax-responsive enhancer element of human T-cell leukemia virus type 1, and may participate in tax-mediated transactivation of transcription. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome. Alternative splicing results in multiple transcript variants.