A1508
ITGAX Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1508
- Additional Names:
- CD11C|ITGAX|SLEB6
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 150kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETT
- Uniprot:
- P20702
- Synonyms:
- CD11 antigen-like family member C;CD11C;complement component 3 receptor 4 subunit;integrin alpha X;integrin alpha-X;integrin, alpha X (antigen CD11C (p150), alpha polypeptide);integrin, alpha X (complement component 3 receptor 4 subunit);Leu M5;leu M5, alpha subunit;leukocyte adhesion glycoprotein p150,95 alpha chain;leukocyte adhesion receptor p150,95;leukocyte surface antigen p150,95, alpha subunit;myeloid membrane antigen, alpha subunit;p150 95 integrin alpha chain;SLEB6
- Extra Details:
- This gene encodes the integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as inactivated-C3b (iC3b) receptor 4 (CR4). The alpha X beta 2 complex seems to overlap the properties of the alpha M beta 2 integrin in the adherence of neutrophils and monocytes to stimulated endothelium cells, and in the phagocytosis of complement coated particles. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice


_WB_01.jpg)
