A15079
PDE7A Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15079
- Additional Names:
- HCP1|PDE7|PDE7A
- Application:
- ELISA, WB
- Molecular Weight:
- 56kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS
- Uniprot:
- Q13946
- Synonyms:
- HCP1;high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A;PDE7;phosphodiesterase isozyme 7;TM22
- Extra Details:
- The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE7 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice