[KO Validated] NDUFC2 Rabbit polyclonal antibody

Size

POA

SKU:: A15073
Additional Names:: B14.5b|C2|CI-B14.5b|HLC-1|MC1DN36|NADHDH2
Application:: ELISA, WB
Molecular Weight:: 14kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDF
Uniprot:: O95298
Synonyms:: B14.5b;CI-B14.5b;complex I subunit B14.5b;complex I-B14.5b;HLC-1;human lung cancer oncogene 1 protein;MC1DN36;NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa;NADH dehydrogenase [ubiquinone] 1 subunit C2;NADH-ubiquinone oxidoreductase subunit B14.5b;NADHDH2
Extra Details:: Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency.