IGFBP4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15068
Additional Names:: BP-4|HT29-IGFBP|IBP4|IGFBP-4|IGFBP4
Application:: ELISA, WB
Molecular Weight:: 28kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
Uniprot:: P22692
Synonyms:: BP-4;HT29-IGFBP;IBP-4;IBP4;IGF-binding protein 4;IGFBP-4;insulin-like growth factor-binding protein 4
Extra Details:: This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.