A15049
DLX5 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15049
- Additional Names:
- DLX5|SHFM1|SHFM1D
- Application:
- ELISA, WB
- Molecular Weight:
- 32kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY
- Uniprot:
- P56178
- Synonyms:
- distal-less homeo box 5;homeobox protein DLX-5;SHFM1;SHFM1D;split hand/foot malformation type 1 with sensorineural hearing loss
- Extra Details:
- This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.
- Shipping Conditions:
- Blue Ice

