A15042
LTB4R Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15042
- Additional Names:
- BLT1|BLTR|CMKRL1|GPR16|LTB4R|LTB4R1|LTBR1|P2RY7|P2Y7
- Application:
- ELISA, WB
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
- Uniprot:
- Q15722
- Synonyms:
- BLT1;BLTR;chemoattractant receptor-like 1;chemokine receptor-like 1;CMKRL1;G protein-coupled receptor 16;G-protein coupled receptor 16;GPR16;leukotriene B4 receptor 1;LTB4-R 1;LTB4-R1;LTB4R1;LTBR1;P2RY7;P2Y purinoceptor 7;P2Y7;purinergic receptor P2Y, G-protein coupled, 7
- Extra Details:
- Predicted to enable G protein-coupled peptide receptor activity and leukotriene B4 receptor activity. Predicted to be involved in inflammatory response and neuropeptide signaling pathway. Predicted to act upstream of or within signal transduction. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane.
- Shipping Conditions:
- Blue Ice

