LTB4R Rabbit polyclonal antibody

Size

£152.00

SKU:: A15042
Additional Names:: BLT1|BLTR|CMKRL1|GPR16|LTB4R|LTB4R1|LTBR1|P2RY7|P2Y7
Application:: ELISA, WB
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Uniprot:: Q15722
Synonyms:: BLT1;BLTR;chemoattractant receptor-like 1;chemokine receptor-like 1;CMKRL1;G protein-coupled receptor 16;G-protein coupled receptor 16;GPR16;leukotriene B4 receptor 1;LTB4-R 1;LTB4-R1;LTB4R1;LTBR1;P2RY7;P2Y purinoceptor 7;P2Y7;purinergic receptor P2Y, G-protein coupled, 7
Extra Details:: Predicted to enable G protein-coupled peptide receptor activity and leukotriene B4 receptor activity. Predicted to be involved in inflammatory response and neuropeptide signaling pathway. Predicted to act upstream of or within signal transduction. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane.