A1500
ZEB1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1500
- Additional Names:
- AREB6|BZP|DELTAEF1|FECD6|NIL2A|PPCD3|TCF8|ZEB1|ZFHEP|ZFHX1A
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 200kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNL
- Uniprot:
- P37275
- Synonyms:
- AREB6;BZP;delta-crystallin enhancer binding factor 1;DELTAEF1;FECD6;negative regulator of IL2;NIL-2-A zinc finger protein;NIL2A;posterior polymorphous corneal dystrophy 3;PPCD3;TCF8;Transcription factor 8;transcription factor 8 (represses interleukin 2 expression);ZFHEP;ZFHX1A;zinc finger E-box-binding homeobox 1;zinc finger homeodomain enhancer-binding protein
- Extra Details:
- This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.
- Shipping Conditions:
- Blue Ice