A14978
UNC5B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14978
- Additional Names:
- p53RDL1|UNC5B|UNC5H2
- Application:
- ELISA, WB
- Molecular Weight:
- 104kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDPNSHLLEASGDAALY
- Uniprot:
- Q8IZJ1
- Synonyms:
- netrin receptor UNC5B;p53-regulated receptor for death and life protein 1;p53RDL1;protein unc-5 homolog 2;protein unc-5 homolog B;transmembrane receptor Unc5H2;unc-5 homolog 2;unc-5 homolog B;UNC5H2
- Extra Details:
- This gene encodes a member of the netrin family of receptors. This particular protein mediates the repulsive effect of netrin-1 and is a vascular netrin receptor. This encoded protein is also in a group of proteins called dependence receptors (DpRs) which are involved in pro- and anti-apoptotic processes. Many DpRs are involved in embryogenesis and in cancer progression. Two alternatively spliced transcript variants have been described for this gene.
- Shipping Conditions:
- Blue Ice