SLC5A9 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14976
Additional Names:: SGLT4|SLC5A9
Application:: ELISA, WB
Molecular Weight:: 74kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LGFQDVGWYPGLEQRYRQAIPNVTVPNTTCHLPRPDAFHILRDPVSGDIPWPGLIFGLTVLATWCWCTDQVIVQRSLSAKSLSHAKGGSVL
Uniprot:: Q2M3M2
Synonyms:: hSGLT4;Na(+)/glucose cotransporter 4;SGLT4;sodium/glucose cotransporter 4;solute carrier family 5 (sodium/glucose cotransporter), member 9;solute carrier family 5 (sodium/sugar cotransporter), member 9;Solute carrier family 5 member 9
Extra Details:: Predicted to enable glucose:sodium symporter activity. Predicted to be involved in sodium ion transport. Located in extracellular exosome.