KCNU1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14967
Additional Names:: KCa5|KCa5.1|Kcnma3|KCNMC1|KCNU1|Slo3|SPGF79
Application:: ELISA, WB
Molecular Weight:: 130kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LELLQMLVTGGVSSQLEQHLDKDKVYGVADSCTSLLSGRNRCKLGLLSLHETILSDVNPRNTFGQLFCGSLDLFGILCVGLYRIIDEEELNPENKRFVITRPANEFKLLPSDLVFCAIPFSTACYKRNEEFSLQKSYEIVNKASQTTETHSDTNCPPTIDSVTETLYSPVYSYQPRTNSLSFPKQIAWNQSRTNSIISSQIPLGDNAKENERKTSDEVYDEDPFAYSEPL
Uniprot:: A8MYU2
Synonyms:: Calcium-activated potassium channel subunit alpha-3;Calcium-activated potassium channel, subfamily M subunit alpha-3;KCa5;KCa5.1;Kcnma3;KCNMC1;potassium channel subfamily U member 1;potassium channel, subfamily U, member 1;Slo3;Slowpoke homolog 3
Extra Details:: This gene encodes a member of the potassium channel family of proteins. The encoded voltage-gated ion channel allows the outward flow of potassium ions during plasma membrane hyperpolarization in sperm. Opening of this channel may be regulated by calcium ion levels. Homozygous knockout mice that lack the related mouse gene exhibit male sterility. Alternative splicing results in multiple transcript variants.