SLCO6A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14963
Additional Names:: CT48|GST|OATP-I|OATP6A1|OATPY|SLCO6A1
Application:: ELISA, WB
Molecular Weight:: 80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VQFAGINEDYDGTGKLGNLTAPCNEKCRCSSSIYSSICGRDDIEYFSPCFAGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL
Uniprot:: Q86UG4
Synonyms:: cancer/testis antigen 48;CT48;gonad-specific transporter;GST;OATP-I;OATP6A1;OATPY;Organic anion-transporting polypeptide 6A1;organic anion-transporting polypeptide I;solute carrier family 21 member 19;solute carrier organic anion transporter family member 6A1;testicular tissue protein Li 174;testis-specific organic anion transporter
Extra Details:: Predicted to enable sodium-independent organic anion transmembrane transporter activity. Predicted to be involved in sodium-independent organic anion transport. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane.