A14961
DNAJC19 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14961
- Additional Names:
- DNAJC19|PAM18|TIM14|TIMM14
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
- Uniprot:
- Q96DA6
- Synonyms:
- DnaJ (Hsp40) homolog, subfamily C, member 19;DnaJ homolog subfamily C member 19;DnaJ-like protein subfamily C member 19;homolog of yeast TIM14;mitochondrial import inner membrane translocase subunit TIM14;PAM18;TIM14;TIMM14
- Extra Details:
- The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19.
- Shipping Conditions:
- Blue Ice



