A14943
RASSF4 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14943
- Additional Names:
- AD037|RASSF4
- Application:
- ELISA, WB
- Molecular Weight:
- 37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQMQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTKSDASCMSQRRPKCRAPGEAQ
- Uniprot:
- Q9H2L5
- Synonyms:
- AD037;Ras association (RalGDS/AF-6) domain family 4;Ras association (RalGDS/AF-6) domain family member 4;Ras association domain family 4;ras association domain-containing protein 4;tumor suppressor RASSF4
- Extra Details:
- The function of this gene has not yet been determined but may involve a role in tumor suppression. Alternative splicing of this gene results in several transcript variants; however, most of the variants have not been fully described.
- Shipping Conditions:
- Blue Ice