TMX1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14936
Additional Names:: PDIA11|TMX|TMX1|TXNDC|TXNDC1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
Uniprot:: Q9H3N1
Synonyms:: PDIA11;protein disulfide isomerase family A, member 11;thioredoxin domain containing 1;thioredoxin domain-containing protein 1;thioredoxin-related transmembrane protein 1;TMX;transmembrane Trx-related protein;TXNDC;TXNDC1
Extra Details:: This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and one transmembrane domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The mature membrane-bound protein can both oxidize and reduce disulfide bonds and acts selectively on membrane-associated polypeptides.