OXCT2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14920
Additional Names:: FKSG25|OXCT2|SCOTT
Application:: ELISA, WB, IF
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTGCAFAVSPNLR
Uniprot:: Q9BYC2
Synonyms:: 3-oxoacid CoA-transferase 2A;FKSG25;SCOTT;succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial;testis-specific succinyl CoA:3-oxoacid CoA-transferase;Testis-specific succinyl-CoA:3-oxoacid CoA-transferase
Extra Details:: The protein encoded by this gene catalyzes the transfer of a CoA group from succinate to acetoacetate and is an important enzyme in ketone body catabolism. The encoded protein localizes to the mitochondrion. This gene is intronless, and a pseudogene of this gene is located elsewhere on chromosome 1.