A14906
BATF3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14906
- Additional Names:
- BATF3|JDP1|JUNDM1|SNFT
- Application:
- ELISA, WB
- Molecular Weight:
- 14kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
- Uniprot:
- Q9NR55
- Synonyms:
- 21 kDa small nuclear factor isolated from T-cells;21-kD small nuclear factor isolated from T cells;B-ATF-3;basic leucine zipper transcription factor, ATF-like 3;basic leucine zipper transcriptional factor ATF-like 3;JDP1;Jun dimerization protein 1;Jun dimerization protein p21SNFT;JUNDM1;SNFT
- Extra Details:
- This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.
- Shipping Conditions:
- Blue Ice