[KO Validated] CHRAC1 Rabbit polyclonal antibody

Size

POA

SKU:: A14896
Additional Names:: C1|CHARC1|CHARC15|CHRAC-1|CHRAC-15|CHRAC15|YCL1
Application:: ELISA, WB
Molecular Weight:: 14kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
Uniprot:: Q9NRG0
Synonyms:: CHARC1;CHARC15;CHRAC-1;CHRAC-15;CHRAC15;chromatin accessibility complex 1;chromatin accessibility complex 15 kDa protein;chromatin accessibility complex protein 1;DNA polymerase epsilon subunit p15;histone-fold protein CHRAC15;YCL1
Extra Details:: CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.