A14888
GOLGA7 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14888
- Additional Names:
- GCP16|GOLGA3AP1|GOLGA7|GOLGA7A|HSPC041
- Application:
- ELISA, WB
- Molecular Weight:
- 16kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVFRLKLPFMKTEA
- Uniprot:
- Q7Z5G4
- Synonyms:
- GCP16;GOLGA3AP1;GOLGA7A;golgi autoantigen, golgin subfamily a, 7;golgi complex-associated protein of 16 kDa;Golgi complex-associated protein of 16kDa;golgin subfamily A member 7;HSPC041
- Extra Details:
- Involved in Golgi to plasma membrane protein transport; peptidyl-L-cysteine S-palmitoylation; and protein stabilization. Acts upstream of or within Golgi to plasma membrane transport. Located in Golgi membrane and Golgi stack. Is intrinsic component of Golgi membrane. Part of palmitoyltransferase complex.
- Shipping Conditions:
- Blue Ice