Bif-1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14887
Additional Names:: Bif-1|CGI-61|dJ612B15.2|PPP1R70
Application:: ELISA, WB, IHC-P
Molecular Weight:: 41kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIGSSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITYLELLN
Uniprot:: Q9Y371
Synonyms:: Bax-interacting factor 1;Bif-1;CGI-61;dJ612B15.2;endophilin-B1;PPP1R70;protein phosphatase 1, regulatory subunit 70;SH3 domain-containing GRB2-like protein B1;SH3-containing protein SH3GLB1;SH3-domain GRB2 like endophilin B1;testicular tissue protein Li 172
Extra Details:: This gene encodes a SRC homology 3 domain-containing protein. The encoded protein interacts with the proapoptotic member of the Bcl-2 family, Bcl-2-associated X protein (Bax) and may be involved in regulating apoptotic signaling pathways. This protein may also be involved in maintaining mitochondrial morphology. Alternate splicing results in multiple transcript variants.