SLC40A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14884
Additional Names:: FPN|FPN1|HFE4|IREG1|MST079|MSTP079|MTP1|SLC11A3|SLC40A1
Application:: ELISA, WB
Molecular Weight:: 62-70kDa/62 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWV
Uniprot:: Q9NP59
Synonyms:: Ferroportin-1;FPN1;HFE4;IREG1;iron regulated gene 1;Iron-regulated transporter 1;MST079;MSTP079;MTP1;SLC11A3;solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3;solute carrier family 40 (iron-regulated transporter), member 1;solute carrier family 40 member 1
Extra Details:: The protein encoded by this gene is a cell membrane protein that may be involved in iron export from duodenal epithelial cells. Defects in this gene are a cause of hemochromatosis type 4 (HFE4).