pAbPC1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14872
Additional Names:: PAB1|PABP|PABP1|pAbPC1|PABPC2|PABPL1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNM
Uniprot:: P11940
Synonyms:: PAB1;PABP;PABP1;PABPC2;PABPL1;poly(A) binding protein, cytoplasmic 2;polyadenylate-binding protein 1
Extra Details:: This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3' poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitment and translation initiation; it is also required for poly(A) shortening which is the first step in mRNA decay. The gene is part of a small gene family including three protein-coding genes and several pseudogenes.