A14868
ATRNL1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14868
- Additional Names:
- ALP|ATRNL1|bA338L11.1|bA454H24.1
- Application:
- ELISA, WB
- Molecular Weight:
- 153kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LYAQVSQSKPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLI
- Uniprot:
- Q5VV63
- Synonyms:
- ALP;attractin-like protein 1;bA338L11.1;bA454H24.1
- Extra Details:
- Predicted to enable carbohydrate binding activity. Predicted to be involved in several processes, including animal organ morphogenesis; cell migration; and substrate adhesion-dependent cell spreading. Predicted to act upstream of or within G protein-coupled receptor signaling pathway. Predicted to be located in membrane. Predicted to be integral component of membrane. Predicted to be active in basement membrane.
- Shipping Conditions:
- Blue Ice