A14850
TCERG1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14850
- Additional Names:
- CA150|TAF2S|TCERG1|Urn1
- Application:
- ELISA, WB
- Molecular Weight:
- 160kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKA
- Uniprot:
- O14776
- Synonyms:
- CA150;co-activator of 150 kDa;TAF2S;TATA box binding protein (TBP)-associated factor, RNA polymerase II, S, 150kD;TATA box-binding protein-associated factor 2S;transcription elongation regulator 1;transcription factor CA150;Urn1
- Extra Details:
- This gene encodes a nuclear protein that regulates transcriptional elongation and pre-mRNA splicing. The encoded protein interacts with the hyperphosphorylated C-terminal domain of RNA polymerase II via multiple FF domains, and with the pre-mRNA splicing factor SF1 via a WW domain. Alternative splicing results in multiple transcripts variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice