A14847
ZNF273 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14847
- Additional Names:
- HZF9|ZNF273
- Application:
- ELISA, WB
- Molecular Weight:
- 65kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ECGKSCCILSQLTQHKKTATRVNFYKCKTCGKAFNQFSNLTKHKIIHPEVN
- Uniprot:
- Q14593
- Synonyms:
- HZF9;zinc finger protein 273;zinc finger protein 9;zinc finger protein HZF9
- Extra Details:
- This gene is a member of the krueppel C2H2-type zinc-finger protein family and encodes a protein with 13 C2H2-type zinc fingers and a KRAB domain. This nuclear protein is involved in transcriptional regulation. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice