EBP Rabbit polyclonal antibody

Size

£152.00

SKU:: A14845
Additional Names:: CDPX2|CHO2|CPX|CPXD|EBP|MEND
Application:: ELISA, WB
Molecular Weight:: 26kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SGRAAVVPLGTWRRLSLCWFAVCGFIHLVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITACLWGPLSLWVVIAFLRQHPLRFIL
Uniprot:: Q15125
Synonyms:: 3-beta-hydroxysteroid-delta-8,delta-7-isomerase;3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase;CDPX2;CHO2;cholestenol Delta-isomerase;Chondrodysplasia punctata-2, X-linked dominant (Happle syndrome);CPX;CPXD;D8-D7 sterol isomerase;delta(8)-Delta(7) sterol isomerase;emopamil binding protein (sterol isomerase);emopamil-binding protein;MEND;sterol 8-isomerase
Extra Details:: The protein encoded by this gene is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved in the transport of cationic amphiphilics. Another prominent feature of this protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in this gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome).

Shipping Conditions:: Blue Ice