A14838
EMC8 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14838
- Additional Names:
- C16orf2|C16orf4|COX4NB|EMC8|FAM158B|NOC4
- Application:
- ELISA, WB
- Molecular Weight:
- 24kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
- Uniprot:
- O43402
- Synonyms:
- C16orf2;C16orf4;COX4 neighbor;COX4NB;ER membrane protein complex subunit 8;FAM158B;family with sequence similarity 158, member B;neighbor of COX4;NOC4;Protein FAM158B
- Extra Details:
- Contributes to membrane insertase activity. Involved in protein insertion into ER membrane by stop-transfer membrane-anchor sequence and tail-anchored membrane protein insertion into ER membrane. Located in cytosol. Part of EMC complex.
- Shipping Conditions:
- Blue Ice