TLK1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14831
Additional Names:: PKU-beta|TLK1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 87kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQ
Uniprot:: Q9UKI8
Synonyms:: PKU-beta;serine threonine protein kinase;serine/threonine-protein kinase tousled-like 1;SNARE protein kinase SNAK;Tousled-like kinase 1
Extra Details:: The protein encoded by this gene is a serine/threonine kinase that may be involved in the regulation of chromatin assembly. The encoded protein is only active when it is phosphorylated, and this phosphorylation is cell cycle-dependent, with the maximal activity of this protein coming during S phase. The catalytic activity of this protein is diminished by DNA damage and by blockage of DNA replication. Three transcript variants encoding different isoforms have been found for this gene.