A14825
SLC4A8 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14825
- Additional Names:
- NBC3|NDCBE|SLC4A8
- Application:
- ELISA, WB
- Molecular Weight:
- 123kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEAL
- Uniprot:
- Q2Y0W8
- Synonyms:
- electroneutral Na(+)-driven Cl-HCO3 exchanger;electroneutral sodium bicarbonate exchanger 1;k-NBC3;NBC3;NDCBE;Solute carrier family 4 member 8;solute carrier family 4, sodium bicarbonate cotransporter, member 8
- Extra Details:
- The protein encoded by this gene is a membrane protein that functions to transport sodium and bicarbonate ions across the cell membrane. The encoded protein is important for pH regulation in neurons. The activity of this protein can be inhibited by 4,4'-Di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS). Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

