A14819
LPAR2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14819
- Additional Names:
- EDG-4|EDG4|LPA-2|LPA2|LPAR2
- Application:
- ELISA, WB
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDST
- Uniprot:
- Q9HBW0
- Synonyms:
- EDG-4;EDG4;endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 4;G protein-coupled receptor;LPA receptor 2;LPA receptor EDG4;LPA-2;LPA2;lysophosphatidic acid receptor 2;lysophosphatidic acid receptor Edg-4;lysophosphatidic acid receptor EDG4
- Extra Details:
- This gene encodes a member of family I of the G protein-coupled receptors, as well as the EDG family of proteins. This protein functions as a lysophosphatidic acid (LPA) receptor and contributes to Ca2+ mobilization, a critical cellular response to LPA in cells, through association with Gi and Gq proteins. An alternative splice variant has been described but its full length sequence has not been determined.
- Shipping Conditions:
- Blue Ice