SLC16A4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14818
Additional Names:: MCT4|MCT5|SLC16A4
Application:: ELISA, WB
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT
Uniprot:: O15374
Synonyms:: MCT 4;MCT 5;MCT4;MCT5;monocarboxylate transporter 4;monocarboxylate transporter 5;solute carrier family 16 (monocarboxylic acid transporters), member 4;Solute carrier family 16 member 4;solute carrier family 16, member 4 (monocarboxylic acid transporter 5)
Extra Details:: Predicted to enable monocarboxylic acid transmembrane transporter activity. Predicted to be involved in monocarboxylic acid transport. Predicted to be located in membrane. Predicted to be integral component of plasma membrane.