PRPF4B Rabbit polyclonal antibody

Size

£152.00

SKU:: A14815
Additional Names:: dJ1013A10.1|PR4H|PRP4|PRP4H|PRP4K|PRPF4B
Application:: ELISA, WB
Molecular Weight:: 160kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHK
Uniprot:: Q13523
Synonyms:: dJ1013A10.1;dJ1013A10.1 (PRP4 protein kinase homolog);PR4H;protein-serine/threonine kinase;PRP4;PRP4 kinase;PRP4 pre-mRNA processing factor 4 homolog B;PRP4 pre-mRNA-processing factor 4 homolog;PRP4H;PRP4K;serine/threonine-protein kinase PRP4 homolog
Extra Details:: Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs).