A14815
PRPF4B Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14815
- Additional Names:
- dJ1013A10.1|PR4H|PRP4|PRP4H|PRP4K|PRPF4B
- Application:
- ELISA, WB
- Molecular Weight:
- 160kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHK
- Uniprot:
- Q13523
- Synonyms:
- dJ1013A10.1;dJ1013A10.1 (PRP4 protein kinase homolog);PR4H;protein-serine/threonine kinase;PRP4;PRP4 kinase;PRP4 pre-mRNA processing factor 4 homolog B;PRP4 pre-mRNA-processing factor 4 homolog;PRP4H;PRP4K;serine/threonine-protein kinase PRP4 homolog
- Extra Details:
- Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs).
- Shipping Conditions:
- Blue Ice

