A14813
AKAP4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14813
- Additional Names:
- AKAP 82|AKAP-4|AKAP4|AKAP82|CT99|FSC1|hAKAP82|HI|p82|PRKA4
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 82kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QSPSAPPAKPPSTQRAVISPDGECSIDDLSFYVNRLSSLVIQMAHKEIKEKLEGKSKCLHHSICPSPGNKERISPRTPASKIASEMAYEAVELTAAEMRGTGEESREGGQKSFLYSELSNKSKSGDKQMSQRESKEFADSISKGLMVYANQV
- Uniprot:
- Q5JQC9
- Synonyms:
- A kinase (PRKA) anchor protein 4;A-kinase anchor protein 4;A-kinase anchor protein 82 kDa;AKAP 82;AKAP-4;AKAP82;cancer/testis antigen 99;CT99;epididymis secretory sperm binding protein;FSC1;hAKAP82;HI;major sperm fibrous sheath protein;p82;PRKA4;protein kinase A anchoring protein 4;Protein kinase A-anchoring protein 4;testis-specific gene HI
- Extra Details:
- The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice





