A14809
UNC5C Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14809
- Additional Names:
- UNC5C|UNC5H3
- Application:
- ELISA, WB
- Molecular Weight:
- 103kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
- Uniprot:
- O95185
- Synonyms:
- netrin receptor UNC5C;protein unc-5 homolog 3;protein unc-5 homolog C;unc-5 homolog 3;unc-5 homolog C;unc5 (C.elegans homolog) c;UNC5H3
- Extra Details:
- This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
- Shipping Conditions:
- Blue Ice