FSHR Rabbit polyclonal antibody

Size

£152.00

SKU:: A1480
Additional Names:: FSHR|FSHR1|FSHRO|LGR1|ODG1
Application:: ELISA, WB, IF
Molecular Weight:: 72kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTSGSTYILVPLSHLAQN
Uniprot:: P23945
Synonyms:: follicle-stimulating hormone receptor;follitropin receptor;FSH receptor;FSHR1;FSHRO;LGR1;ODG1
Extra Details:: The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Mutations in this gene cause ovarian dysgenesis type 1, and also ovarian hyperstimulation syndrome. Alternative splicing results in multiple transcript variants.