A14794
TYROBP Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14794
- Additional Names:
- DAP12|KARAP|PLOSL|PLOSL1|TYROBP
- Application:
- ELISA, WB
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
- Uniprot:
- O43914
- Synonyms:
- DAP12;DNAX adaptor protein 12;DNAX-activation protein 12;KAR-associated protein;KARAP;killer-activating receptor-associated protein;PLOSL;PLOSL1;polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy;TYRO protein tyrosine kinase binding protein;TYRO protein tyrosine kinase-binding protein
- Extra Details:
- This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene.
- Shipping Conditions:
- Blue Ice

