A14776
RBBP6 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14776
- Additional Names:
- MY038|P2P-R|PACT|RBBP6|RBQ-1|SNAMA
- Application:
- ELISA, WB
- Molecular Weight:
- 210kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SKVKQEKVKGKVRRKVTGTEGSSSTLVDYTSTSSTGGSPVRKSEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTK
- Uniprot:
- Q7Z6E9
- Synonyms:
- E3 ubiquitin-protein ligase RBBP6;MY038;P2P-R;p53-associated cellular protein of testis;PACT;proliferation potential-related protein;protein P2P-R;RB-binding Q-protein 1;RBQ-1;retinoblastoma binding protein 6;Retinoblastoma-binding protein 6;retinoblastoma-binding Q protein 1;RING-type E3 ubiquitin transferase RBBP6;SNAMA
- Extra Details:
- The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

