Cytokeratin 12 (KRT12) Rabbit polyclonal antibody

Size

£152.00

SKU:: A14746
Additional Names:: Cytokeratin 12 (KRT12)|K12|MECD1
Application:: ELISA, WB
Molecular Weight:: 56kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TRLLNDMRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM
Uniprot:: Q99456
Synonyms:: CK-12;cytokeratin-12;K12;keratin 12, type I;Keratin-12;keratin, type I cytoskeletal 12;MECD1
Extra Details:: KRT12 encodes the type I intermediate filament chain keratin 12, expressed in corneal epithelia. Mutations in this gene lead to Meesmann corneal dystrophy.