A14744
ISG20 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14744
- Additional Names:
- CD25|HEM45|ISG20
- Application:
- ELISA, WB
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF
- Uniprot:
- Q96AZ6
- Synonyms:
- CD25;estrogen-regulated transcript 45 protein;HEM45;interferon stimulated exonuclease gene 20kDa;interferon-stimulated gene 20 kDa protein;promyelocytic leukemia nuclear body-associated protein ISG20
- Extra Details:
- Enables 3'-5' exonuclease activity and RNA binding activity. Involved in defense response to virus; negative regulation of viral genome replication; and nucleobase-containing compound catabolic process. Located in cytoplasm and nuclear lumen.
- Shipping Conditions:
- Blue Ice