HCRTR1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14740
Additional Names:: HCRTR1|ORXR1|OX1R|OXR1
Application:: ELISA, WB, IF
Molecular Weight:: 48kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGT
Uniprot:: O43613
Synonyms:: hypocretin (orexin) receptor 1;hypocretin receptor type 1;orexin receptor 1;orexin receptor type 1;ORXR1;OX1R;OXR1
Extra Details:: The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B.