A14737
GNAZ Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14737
- Additional Names:
- GNAZ|gz-alpha|HG1H
- Application:
- ELISA, WB
- Molecular Weight:
- 41kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK
- Uniprot:
- P19086
- Synonyms:
- g(x) alpha chain;guanine nucleotide binding protein (G protein), alpha z polypeptide;guanine nucleotide-binding protein G(z) subunit alpha;gz-alpha;transducin alpha
- Extra Details:
- The protein encoded by this gene is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This encoded protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.
- Shipping Conditions:
- Blue Ice